DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:245 Identity:67/245 - (27%)
Similarity:114/245 - (46%) Gaps:28/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEA---EVPWMVALL-DARTSSYVAGGALIAPHVVITARQ-----RTENMTASQLVVRAGEWDFS 169
            |||   :.|:.:||| :..|.:.:.||:::..:.::||..     .|...|:...::.|...:.:
Mosquito    77 QEATPGQFPYQIALLSNFATGTGLCGGSVLTNNYILTAAHCVISGATTLATSGTAIMGAHNRNVN 141

  Fly   170 TKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF 234
            ..|:|  .:......|..|||:|..|..|::|:|.|...:|.:..|.||.:|....:..|..  |
Mosquito   142 EPTQQ--RIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFTARIQPIRLPGRSDSRQFGG--F 202

  Fly   235 T----GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCE 295
            |    |:|:.: :..:...|:...|.||:....|     :...|...:....:|..|:.|:.||.
Mosquito   203 TGTVSGFGRTT-NTGATSPVVMFTSNPVMTNADC-----IARWNTALIQPQNVCLSGDGGRSSCN 261

  Fly   296 GDGGSPLACAIKDNPQRYELAGIVNFGVDCGLP-GVPAVYTNVANVIEWI 344
            ||.|.||  .::|.....  .|||:||...|.. |:|:||..|:..::||
Mosquito   262 GDSGGPL--TVQDGGSLQ--IGIVSFGSAAGCSIGMPSVYARVSFYLDWI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/243 (27%)
Tryp_SPc 113..344 CDD:238113 65/243 (27%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 65/243 (27%)
Tryp_SPc 73..310 CDD:238113 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.