DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005665

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_556314.2 Gene:AgaP_AGAP005665 / 3290017 VectorBaseID:AGAP005665 Length:300 Species:Anopheles gambiae


Alignment Length:246 Identity:67/246 - (27%)
Similarity:115/246 - (46%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEA---EVPWMVALL-DARTSSYVAGGALIAPHVVITARQRTENMTASQL------VVRAGEWDF 168
            |||   :.|:.:||| :..|.:.:.||:::..:.::||.....: .||.|      ::.|...|.
Mosquito    59 QEATPGQFPYQIALLSNFPTGTGLCGGSVLTNNYILTAAHCVIS-GASTLALGGTAIIGAHNRDV 122

  Fly   169 STKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCI 233
            :..::|  .:......|..|||:.|.|..|::|:|.|...:|.:..|.|..:|:......|..  
Mosquito   123 AEPSQQ--RIAFSTAGIRAHPGYTLTNIRNDIAVVRLNSPITFTDRIQPARLPARSDTRQFGG-- 183

  Fly   234 FT----GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
            ||    |:|:.|....:..:|:...:.||:....|..|     .|...::...:|..|..|:.||
Mosquito   184 FTGTVSGFGRTSDASQATSSVVMFTTNPVLTNADCIAQ-----WNAVVIEPQNVCLSGAGGRSSC 243

  Fly   295 EGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLP-GVPAVYTNVANVIEWI 344
            .||.|.||  |::|.....  .|:|:||...|.. |:|:||..|:..:::|
Mosquito   244 NGDSGGPL--AVQDGGSLQ--VGVVSFGSAAGCAIGMPSVYARVSFFLDFI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/244 (27%)
Tryp_SPc 113..344 CDD:238113 66/244 (27%)
AgaP_AGAP005665XP_556314.2 Tryp_SPc 54..290 CDD:214473 66/244 (27%)
Tryp_SPc 55..293 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.