DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and psh

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:227 Identity:59/227 - (25%)
Similarity:101/227 - (44%) Gaps:22/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLE 194
            :.:..||:|||...|:||.........:...||.|..:.........  |:.|||:..||.: :.
  Fly   168 TDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQ--DIVIRSVKIHPQY-VG 229

  Fly   195 NGANNVALVFLRRSLTSSRHINPICM----PSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKIS 255
            |..|::|::.|.|.:..:.:|.|.|:    ...|.|   |:....|||..:....:...:|.:..
  Fly   230 NKYNDIAILELERDVVETDNIRPACLHTDATDPPSN---SKFFVAGWGVLNVTTRARSKILLRAG 291

  Fly   256 LPVVQRRTC-----EQ--QLRLYYGNDFELDNSLMCAGGEP-GKDSCEGDGGSPLACAIKDNPQR 312
            |.:|....|     ||  .:||....   :.:||:||..:. ..|:|:||.|.||...:......
  Fly   292 LELVPLDQCNISYAEQPGSIRLLKQG---VIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGM 353

  Fly   313 YELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.:.|:::.|..|... .|.:||.|::.:::|
  Fly   354 YTIMGVISSGFGCATV-TPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 58/225 (26%)
Tryp_SPc 113..344 CDD:238113 58/225 (26%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 58/225 (26%)
Tryp_SPc 144..387 CDD:238113 59/227 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.