DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and plg

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:239 Identity:71/239 - (29%)
Similarity:116/239 - (48%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITAR---QRTENMTASQLVV-----RAGEWDFSTKTEQL 175
            ||.:: |..|...:..||.||.|..|:||.   :|:::.:|.::::     ||.|   |:|.|: 
Zfish   601 PWQIS-LRTRGKIHFCGGTLIDPQWVVTAAHCLERSDSPSAYKIMLGIHTERATE---SSKQER- 660

  Fly   176 PSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS----APKNFDFSRCIFTG 236
                 .:..|::.|      ...::||:.|.|....:..::|:|:|.    .|.|   :.|..||
Zfish   661 -----DVTKIIKGP------AGTDIALLKLDRPALINDKVSPVCLPEKDYIVPSN---TECYVTG 711

  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGS 300
            ||:.  .|......||:...||::.:.|.   |..:.|....|:. ||||. |.|.|||:||.|.
Zfish   712 WGET--QDTGGEGYLKETGFPVIENKVCN---RPSFLNGRVKDHE-MCAGNIEGGNDSCQGDSGG 770

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||.|..::.   :.|.|:.::|:.|.....|.|||.|:..::||
Zfish   771 PLVCYAQNT---FVLQGVTSWGLGCANAMKPGVYTRVSKFVDWI 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/237 (29%)
Tryp_SPc 113..344 CDD:238113 69/237 (29%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527
Tryp_SPc 589..813 CDD:238113 71/239 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.