DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:272 Identity:77/272 - (28%)
Similarity:128/272 - (47%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EPITDPQCGFVNSKGVTFS--FREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITAR 148
            |.|.:..||    .|:.:.  .|..|...|.:|..||..:|  .....::.|.:||....::|:.
Mouse   167 EHILNSDCG----SGMEYPPIARIADGKPADKASWPWQSSL--QVEGIHLCGASLIGSQWLVTSA 225

  Fly   149 QRTENMTASQLVVRAGEWDFS-TKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSS 212
            ...:|....:|      |..| .:|...|.....:.||:.|..:......:::|:|.|...:..|
Mouse   226 HCFDNYKNPKL------WTVSFGRTLSSPLTTRKVESIIVHENYASHKHDDDIAVVKLSSPVLFS 284

  Fly   213 RHINPICMPSA-----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYY 272
            .:::.:|:|.|     ||    |:...||||....:.| :.|.|:::.:.::....| .|:.:|.
Mouse   285 ENLHRVCLPDATFQVLPK----SKVFVTGWGALKANGP-FPNSLQEVEIEIISNDVC-NQVNVYG 343

  Fly   273 GNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTN 336
            |   .:.:.::|||...|| |:||||.|.||  .|.||..::.|.|||::|:|||....|.:||.
Mouse   344 G---AISSGMICAGFLTGKLDACEGDSGGPL--VISDNRNKWYLLGIVSWGIDCGKENKPGIYTR 403

  Fly   337 VANVIEWITLTT 348
            |.:..:||...|
Mouse   404 VTHYRDWIKSKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/237 (28%)
Tryp_SPc 113..344 CDD:238113 67/237 (28%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 69/244 (28%)
Tryp_SPc 186..414 CDD:238113 70/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.