DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG32376

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:222 Identity:57/222 - (25%)
Similarity:96/222 - (43%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YVAGGALIAPHVVITARQ----RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFN 192
            :|.|..:|....::||..    ..|..|     ||.|. |...:..||..|    :.||....:|
  Fly    89 FVCGCVIINKIWILTAHHCFFGPPEKYT-----VRVGS-DQQRRGGQLRHV----KKIVALAAYN 143

  Fly   193 LENGANNVALVFLRRSLTSSRHINPICMPSA-----PKNFDFSRCIFTGWGKNSFDDPSYMNVLK 252
            .....:::|::.|:..:...:.:.|:.:||.     ||.|     :.:|||..|.:..:....|:
  Fly   144 DYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKF-----VVSGWGITSANAQNVQRYLR 203

  Fly   253 KISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAG 317
            ::.:..::|..|:   ::|.....::...::|| ....||||.||.|.||.       .|..|.|
  Fly   204 RVQIDYIKRSKCQ---KMYKKAGLKIYKDMICA-SRTNKDSCSGDSGGPLT-------SRGVLYG 257

  Fly   318 IVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||::|:.|.....|.||.|....:.||
  Fly   258 IVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 55/220 (25%)
Tryp_SPc 113..344 CDD:238113 55/220 (25%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 55/220 (25%)
Tryp_SPc 66..287 CDD:238113 57/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.