DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and spirit

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:117/257 - (45%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVAL-----LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLP 176
            |.|:|.||     .|.|. .|..||||||.:.|:||....:........||.| .|..|.||   
  Fly   142 EFPFMAALGWRSNFDQRI-YYRCGGALIANNFVLTAAHCADLGGEPPSQVRLG-GDNLTLTE--- 201

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT--GWGK 239
            ..|:.||.::.||.::.....|::||:.|..:  :...:.|.|:.:..   :.:..:.|  |:|:
  Fly   202 GEDISIRRVIIHPDYSASTAYNDIALLELETA--AKPELKPTCIWTQK---EVTNTLVTAIGYGQ 261

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSL---MCAGGEPG-KDSCEGDGGS 300
            .||...|...:| |:.|..|....|:.    :|..|......|   ||||...| :|:|:||.|.
  Fly   262 TSFAGLSSAQLL-KVPLKSVSNEECQH----HYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGG 321

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI------TLTTVNMPLPEE 356
            ||  .::|....| :.||.:.|..|. .|.|:|||.|::.::||      .....|.|.|.:
  Fly   322 PL--LMQDGLLGY-VVGITSLGQGCA-SGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/237 (31%)
Tryp_SPc 113..344 CDD:238113 73/237 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 75/240 (31%)
Tryp_SPc 132..361 CDD:214473 73/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.