DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG1632

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:383 Identity:73/383 - (19%)
Similarity:129/383 - (33%) Gaps:109/383 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDT--GLAQEAEVPWMVALLDARTSSYV 133
            ||:       |.::.....:.:||.   :...|:.::..:  .::...:.||:|||.  |...:|
  Fly   674 CPR-------RQVLYVGCGELRCGV---QSALFNAKQHLSLPKMSAPGDWPWLVALF--REDIHV 726

  Fly   134 AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTK---TEQLPSVDVPIRSIVRHPGFNLEN 195
            ..|.||....|:|.....:....:..:...|....|.|   |::...:.: |:|.|.        
  Fly   727 CDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAPWTQRRRIIGM-IKSPVE-------- 782

  Fly   196 GANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQ 260
             .:..|||.|...::.|.|:.|||:|.|.:             :.....|.   ..::..:||.:
  Fly   783 -GSTAALVRLETPVSYSDHVRPICLPDALQ-------------RRLLQQPP---AQRRSHVPVAE 830

  Fly   261 R----RTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF 321
            |    ...:|:.||...|    ....:....|....|.|..|.       :|..::.:     :|
  Fly   831 RLEGQLVSQQRSRLSQEN----QQFFLIPSQEQQDSSTENQGD-------EDQDEQED-----HF 879

  Fly   322 GVDCG---LPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYAS------------------P 365
            |.:..   :|...|::..:.           ..|||:...:|.|.|                  |
  Fly   880 GGESAASYMPKAEALHQELD-----------GYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAP 933

  Fly   366 TLSAGPYLNQ--WNQPNYEWLPTGYPNVNSIPWQLQEANNDLANSQYVRYYPVENVGI 421
            .|:|.|...:  |.            |.|::.|..|..:......:.....|.|||.|
  Fly   934 ILAAVPAAQEQIWT------------NCNTLGWSRQRDHLQRVQLKMGDMAPCENVSI 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 47/240 (20%)
Tryp_SPc 113..344 CDD:238113 47/240 (20%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 29/112 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.