DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Ovch2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:131/282 - (46%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITDPQCGFVNSKGVT-------FSFREEDTGLAQ--EAEVPWMVALLDARTSSYVAGGALIAPHV 143
            |..|.||    |.:.       ||......|.:|  :...||.|:|  .:...::.||.:|:...
  Rat    28 IRAPDCG----KSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSL--KQKQKHICGGTIISSQW 86

  Fly   144 VITARQRTENMT-ASQLVVRAGEWDFSTKT--EQLPSVDVPIRSIVRHPGFNLENGAN-NVALVF 204
            ||||.....|.. |..|.|.|||.|.|...  ||    .:.|.:|:.||.|:.:...| ::||:.
  Rat    87 VITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQ----TLAIETIIIHPQFSTKKPMNYDIALLK 147

  Fly   205 LRRSLTSSRHINPICMPSAPKNFDFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQL 268
            :..:....:.:.|:|:|...:.|:... |...|||:.| :..|...||::::||::....|| .:
  Rat   148 MVGTFQFGQFVRPVCLPEPGEQFNAGYICTTAGWGRLS-EGGSLPQVLQQVNLPILTHEECE-AV 210

  Fly   269 RLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGL----- 327
            .|...|.. ...:.:|.|. :.|:|:|:||.|..|.|  ::....:.|||:.::|:.||.     
  Rat   211 MLTLRNPI-TGKTFLCTGSPDGGRDACQGDSGGSLMC--QNRKGAWTLAGVTSWGLGCGRSWRNN 272

  Fly   328 -----PGVPAVYTNVANVIEWI 344
                 .|.|.::|::..|:.||
  Rat   273 ARKKEQGSPGIFTDLRRVLPWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/248 (28%)
Tryp_SPc 113..344 CDD:238113 69/248 (28%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 72/254 (28%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.