DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and HGFAC

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001284368.1 Gene:HGFAC / 3083 HGNCID:4894 Length:662 Species:Homo sapiens


Alignment Length:234 Identity:68/234 - (29%)
Similarity:110/234 - (47%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            ||:.|:...  .|:.||..:....||..|...:.:.....:.|..|:..|:..|:...:..  |.
Human   427 PWLAAIYIG--DSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFG--IE 487

  Fly   184 SIVRHPGFNLENGANNVALVFLR------RSLTSSRHINPICMPSAPKNFDFS-RCIFTGWGKNS 241
            ..:.:..:::.|.::: .||.:|      |..|.|:.:.|||:|.....|... :|...|||...
Human   488 KYIPYTLYSVFNPSDH-DLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLD 551

  Fly   242 FDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACA 305
            .:...|.:.|::..:|:|....|...  ..||.|  :..:::|||....| |:|:||.|.|||| 
Human   552 ENVSGYSSSLREALVPLVADHKCSSP--EVYGAD--ISPNMLCAGYFDCKSDACQGDSGGPLAC- 611

  Fly   306 IKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
             :.|...| |.||:::|..||....|.|||.|||.::||
Human   612 -EKNGVAY-LYGIISWGDGCGRLHKPGVYTRVANYVDWI 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/232 (28%)
Tryp_SPc 113..344 CDD:238113 66/232 (28%)
HGFACNP_001284368.1 PRR18 34..>169 CDD:292299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..102
FN2 102..148 CDD:128373
EGF_CA 162..197 CDD:238011
FN1 200..240 CDD:238018
EGF_CA 245..278 CDD:238011
Kringle 286..367 CDD:278480
Tryp_SPc 414..648 CDD:214473 66/232 (28%)
Tryp_SPc 415..650 CDD:238113 68/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.