DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F12

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:234 Identity:70/234 - (29%)
Similarity:114/234 - (48%) Gaps:18/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTA-SQLVVRAGEWDFSTKTEQLPSVDVPI 182
            |::.||...  .|:.| |:||.|..|:||....:...| .:|.|..|:...:...|:..:  :.:
  Rat   374 PYIAALYWG--DSFCA-GSLIDPCWVLTAAHCLQKRPAPEELTVVLGQDRHNQSCERCQT--LAV 433

  Fly   183 RSIVRHPGFNLENGANNVALVFLRRSLTS----SRHINPICMPS--APKNFDFSRCIFTGWGKNS 241
            .|...|.||:.:...:::||:.||....|    |.|:.|:|:||  ||.: :...|...|||...
  Rat   434 HSYRLHEGFSSKTYQHDLALLRLRGRKNSCAILSPHVQPVCLPSSAAPPS-ETVLCEVAGWGHQF 497

  Fly   242 FDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACA 305
            .....|...|::..:|.:....|...  ..:|:  .:...::|||. |.|.|:|:||.|.||.|.
  Rat   498 EGAEEYATFLQEAQVPFISLDRCSSS--NVHGD--AILPGMLCAGFLEGGADACQGDSGGPLVCD 558

  Fly   306 IKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .....::..|.|::::|..||....|.|||:|||.::||
  Rat   559 EGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWI 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/232 (29%)
Tryp_SPc 113..344 CDD:238113 68/232 (29%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480
Tryp_SPc 361..597 CDD:214473 68/232 (29%)
Tryp_SPc 362..600 CDD:238113 70/234 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.