DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss22

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:267 Identity:80/267 - (29%)
Similarity:125/267 - (46%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENM- 154
            |.||  ..:.:......||:.   :|:.||:|::| ...|.:.||..|....||..|...:.|| 
  Rat    39 PDCG--KPQQLNRVVGGEDSA---DAQWPWIVSIL-KNGSHHCAGSLLTNRWVVSAAHCFSSNMD 97

  Fly   155 TASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGAN-NVALVFLRRSLTSSRHINPI 218
            ..|...|..|.|.......:  |..|.|.|::.||.::.:.|.: ::|||.|.|.:..|..|.||
  Rat    98 KPSPYSVLLGAWKLGNPGPR--SQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQFSERILPI 160

  Fly   219 CMPSA----PKNFDFSRCIFTGWGKNSFDDPSYM---NVLKKISLPVVQRRTCEQQLRLYY---G 273
            |:|.:    |.|   :.|...|||  |..|...:   ..|:|:.:|::....|:.   ||:   |
  Rat   161 CLPDSSVHLPPN---TNCWIAGWG--SIQDGVPLPRPQTLQKLKVPIIDPELCKS---LYWRGAG 217

  Fly   274 NDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNV 337
            .: .:...::|||...|| |:|.||.|.||.|.:.|:   :.|.||:::|..|.....|.|||::
  Rat   218 QE-AITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDH---WLLTGIISWGEGCAERNRPGVYTSL 278

  Fly   338 ANVIEWI 344
            .....|:
  Rat   279 LAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/243 (30%)
Tryp_SPc 113..344 CDD:238113 74/243 (30%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 76/253 (30%)
Tryp_SPc 50..288 CDD:238113 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.