DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss32

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:301 Identity:83/301 - (27%)
Similarity:145/301 - (48%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITAR---QRT 151
            |..||...:.|...|.:.     ||..:.||.|::.:  ...:|.||:||:...|:||.   .:.
  Rat    42 DSVCGRPRASGRIVSGQN-----AQLGQWPWQVSVRE--DGVHVCGGSLISEDWVLTAAHCFNQD 99

  Fly   152 ENMTA-SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNL-ENGANNVALVFLRRSLTSSRH 214
            ::::| :.|:.....:....:..:|.:|    ...:::|.::. |:.:.::||:.|...::.:.:
  Rat   100 QHLSAYTVLLGTISSYPEDNEPRELRAV----AQYIKYPSYSAEEHSSGDIALLQLASPISFNDY 160

  Fly   215 INPICMPSAPKNFD-FSRCIFTGWGKNSFDDP-SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE 277
            :.|:|:|......| .:.|..||||..:.:.| .....|:::.:|::..:||         |.:.
  Rat   161 MLPVCLPKPGDPLDPGTMCWVTGWGNIATNQPLPPPFTLQELQVPLIDAKTC---------NTYY 216

  Fly   278 LDNS-----------LMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGV 330
            .:||           ::|||...| ||:|.||.|.||.|.:.|   .:..||:|::|.||.|...
  Rat   217 QENSVPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDVND---VWIQAGVVSWGSDCALSNR 278

  Fly   331 PAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGP 371
            |.|||||:..|.||..|..|:|     .|....||:||:.|
  Rat   279 PGVYTNVSVYISWIQNTMWNIP-----TEGKNFSPSLSSTP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/249 (27%)
Tryp_SPc 113..344 CDD:238113 67/249 (27%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 68/261 (26%)
Tryp_SPc 54..295 CDD:238113 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.