DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and HABP2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:245 Identity:76/245 - (31%)
Similarity:116/245 - (47%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLD------ARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            ||..:|..      :....:..|||||.|..|:||...|:..| ..|.|..|:.|.  |.|:...
Human   326 PWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKT-RHLKVVLGDQDL--KKEEFHE 387

  Fly   178 VDVPIRSIVRHPGFNL--ENGANNVALVFLR----RSLTSSRHINPICMP--SAPKNFDFSRCIF 234
            ....:..|.::..:|.  |...|::||:.|:    .....|:::..:|:|  |.|..   |.|..
Human   388 QSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYVKTVCLPDGSFPSG---SECHI 449

  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG--EPGKDSCEGD 297
            :|||.......|...:..|:.|  :....|..: :||   |..:|:|::|||.  :||:|:|:||
Human   450 SGWGVTETGKGSRQLLDAKVKL--IANTLCNSR-QLY---DHMIDDSMICAGNLQKPGQDTCQGD 508

  Fly   298 GGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
            .|.||.|. ||.  .|.:.|||::|::||..  |.|||.|...:.||..|
Human   509 SGGPLTCE-KDG--TYYVYGIVSWGLECGKR--PGVYTQVTKFLNWIKAT 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/240 (30%)
Tryp_SPc 113..344 CDD:238113 73/240 (30%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 75/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.