DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31780 and Sorl1

DIOPT Version :9

Sequence 1:	NP_723920.1	Gene:	CG31780 / 318937	FlyBaseID:	FBgn0051780	Length:	464	Species:	Drosophila melanogaster
Sequence 2:	NP_445971.1	Gene:	Sorl1 / 300652	RGDID:	619914	Length:	2215	Species:	Rattus norvegicus

Alignment Length:	163	Identity:	40/163 - (24%)
Similarity:	64/163 - (39%)	Gaps:	40/163 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   335 TNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGPYLNQWNQPNY------EWLPTGYPNVNS 393
            :.|.|..:::||.|.. .||:....:..:..:...|..|..|..|.:      |:: ..|....|
  Rat  1633 SKVHNTNDFVTLRTPE-GLPDAPRNLQLSLNSEEEGVILGHWAPPVHTHGLIREYI-VEYSRSGS 1695

  Fly   394 IPWQLQ-------EANNDLANSQY-VRYYPVENVGINIHSAGHGNDQQIV-----RPIQ-QDIPK 444
            ..|..|       |..|.|.|:.| ||...|.:.||     |:.:|.:.:     :.|| .:|..
  Rat  1696 KMWASQRAASNSTEIKNLLLNALYTVRVAAVTSRGI-----GNWSDSKSITTTKGKVIQAPNIHI 1755

  Fly   445 DSDDLFNSVFSTTME-------------YNFDA 464
            ||.|..:..|:.||:             ::|||
  Rat  1756 DSYDENSLSFTLTMDGDIKVNGYVVNLFWSFDA 1788

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31780	NP_723920.1	Tryp_SPc	113..344	CDD:214473	2/8 (25%)
CG31780	NP_723920.1	Tryp_SPc	113..344	CDD:238113	2/8 (25%)
Sorl1	NP_445971.1	Cell attachment site. /evidence=ECO:0000255	63..65
		VPS10	124..753	CDD:214740
		BNR 1	136..147
		BNR 2	232..243
		BNR 3	441..452
		BNR 4	521..532
		BNR 5	562..573
		LY	780..821	CDD:214531
		LDL-receptor class B 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00461	800..843
		LY	824..866	CDD:214531
		LDL-receptor class B 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00461	844..887
		LDL-receptor class B 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00461	888..930
		Ldl_recept_b	890..929	CDD:278487
		LY	913..953	CDD:214531
		LDL-receptor class B 4. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00461	931..972
		LY	953..987	CDD:214531
		LDLa	1078..1112	CDD:238060
		LDLa	1117..1153	CDD:238060
		Ldl_recept_a	1157..1192	CDD:365841
		Ldl_recept_a	1198..1230	CDD:365841
		LDLa	1240..1271	CDD:238060
		LDLa	1281..1308	CDD:197566
		LDLa	1325..1359	CDD:238060
		LDLa	1373..1403	CDD:238060
		LDLa	1419..1453	CDD:238060
		LDLa	1471..1506	CDD:238060
		LDLa	1514..1549	CDD:238060
		FN3	1557..1630	CDD:238020
		FN3	1651..1742	CDD:238020	22/96 (23%)
		FN3	1752..1831	CDD:238020	10/37 (27%)
		FN3	1935..2022	CDD:238020
		FN3	2026..2113	CDD:238020
		Potential nuclear localization signal for the C-terminal fragment generated by PSEN1. /evidence=ECO:0000250\|UniProtKB:Q92673	2162..2165
		Endocytosis signal. /evidence=ECO:0000255	2173..2178
		Required for efficient Golgi apparatus -endosome sorting. /evidence=ECO:0000250\|UniProtKB:Q92673	2191..2215
		Required for interaction with GGA1 and GGA2. /evidence=ECO:0000250\|UniProtKB:Q92673	2202..2215
		DXXLL motif involved in the interaction with GGA1. /evidence=ECO:0000250\|UniProtKB:Q92673	2209..2213
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910