DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and GZMM

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:239 Identity:69/239 - (28%)
Similarity:108/239 - (45%) Gaps:32/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQ-RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI 182
            |:|.:|  .|..|::.||.|:.|..|:||.. ..:.|...:||:       ...|...|.:...|
Human    38 PYMASL--QRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVL-------GLHTLDSPGLTFHI 93

  Fly   183 RSIVRHPGFN----LENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSF 242
            ::.::||.:.    ||   |::||:.|...:..||.|.|:.:||..:.... :||...|||. :.
Human    94 KAAIQHPRYKPVPALE---NDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGL-TH 154

  Fly   243 DDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDS--CEGDGGSPLACA 305
            .......||:::.|.|:..|.|... |.:.|:   |..|::|...: .||.  |:||.|.||.|.
Human   155 QGGRLSRVLRELDLQVLDTRMCNNS-RFWNGS---LSPSMVCLAAD-SKDQAPCKGDSGGPLVCG 214

  Fly   306 IKDNPQRYELAGIVNFGVD-CGLPGVPAVYTNVANVIEWITLTT 348
                 :...||.:::|... |.....|.|.|.||..:.||...|
Human   215 -----KGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/233 (28%)
Tryp_SPc 113..344 CDD:238113 66/233 (28%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.