DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Cela3b

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:278 Identity:79/278 - (28%)
Similarity:127/278 - (45%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EPITDPQCGFVNSK-GVTFSFREEDTGLAQEAEVPWMVALLDARTSSY--VAGGALIAPHVVITA 147
            :|..:|....||.: .|.:|:             ||.|:|...:..|:  ..||.||||..|:||
  Rat    19 QPSYNPSSRVVNGEDAVPYSW-------------PWQVSLQYEKDGSFHHTCGGTLIAPDWVMTA 70

  Fly   148 RQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRS--IVRHPGFNLE--NGANNVALVFLRRS 208
            ..........|:|:  ||  |....|:.|...:|:.:  :..||.:|..  :..|::|||.|.||
  Rat    71 GHCISTSRTYQVVL--GE--FERGVEEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDIALVKLSRS 131

  Fly   209 LTSSRHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR 269
            ......:...|:|.|    |..   :.|..:|||:.|.:.| ..:.|::..||||....|.:.  
  Rat   132 AQLGDTVQLACLPPAGEILPNG---APCYISGWGRLSTNGP-LPDKLQQALLPVVDYAHCSKW-- 190

  Fly   270 LYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF--GVDCGLPGVPA 332
            .::|  |.:..:::||||:. :..|.||.|.||.|..::.  .:::.|:.:|  .:.|.....|.
  Rat   191 DWWG--FSVKKTMVCAGGDI-QSGCNGDSGGPLNCPAENG--TWQVHGVTSFVSSLGCNTLKKPT 250

  Fly   333 VYTNVANVIEWITLTTVN 350
            |:|.|:...|||..|..|
  Rat   251 VFTRVSAFNEWIEETIAN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/242 (29%)
Tryp_SPc 113..344 CDD:238113 69/242 (29%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 73/262 (28%)
Tryp_SPc 28..265 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.