DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Klk13

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:108/262 - (41%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQ----------------RTENMTASQLVVRAGEWD 167
            ||..|||  .....:.||.|:.|..|:||..                |.||...:..|||:    
  Rat    49 PWQAALL--VRGRLLCGGVLVHPKWVLTAAHCRKDGYTVHLGKHALGRVENGEQAMEVVRS---- 107

  Fly   168 FSTKTEQLPSVDVPIRSIVRHPGFNLE----NGANNVALVFLRRSLTSSRHINPI------CMPS 222
                              :.||.:.:.    |..:::.|:.|:..:..|.|:..:      |:|:
  Rat   108 ------------------IPHPEYQVSPTHLNHDHDIMLLELKSPVQLSNHVRTLQLSADDCLPT 154

  Fly   223 APKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG- 286
            .      :.|..:|||..:....:|...|:..::.:.....|.|   :|.|   ::..:::||| 
  Rat   155 G------TCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQ---VYPG---KITANMLCAGT 207

  Fly   287 GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWITLTTVN 350
            .|.||||||||.|.||.|..|       |.||:::| ..||.|..|.|||.|:..:.||..|..|
  Rat   208 KEGGKDSCEGDSGGPLICNGK-------LYGIISWGDFPCGQPNRPGVYTRVSKYLRWIQGTIRN 265

  Fly   351 MP 352
            .|
  Rat   266 TP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/252 (26%)
Tryp_SPc 113..344 CDD:238113 66/252 (26%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.