DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F10

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:304 Identity:74/304 - (24%)
Similarity:130/304 - (42%) Gaps:39/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPH 142
            :.|..::|...|:|:   .||..|......::   .:..|.||...|.....:....||.::...
  Rat   209 ESPSELLNLNKTEPE---ANSDDVIRIVGGQE---CKRGECPWQALLFSDEETDGFCGGTILNEF 267

  Fly   143 VVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRR 207
            .::||......  |.:..||.|  |.:|:.|....:...:..|::|..|..:....::|::.|:.
  Rat   268 YILTAAHCLHQ--AKRFKVRVG--DLNTEQEDGGEMVHEVDMIIKHNKFQRDTYDFDIAMLRLKT 328

  Fly   208 SLTSSRHINPICMPSAPKNFDFSRC--------IFTGWGKNSFDDPSYMNVLKKISLPVVQRRTC 264
            .:|...::.|.|:|..    |::..        |.:|:|: :.:......|||.:.:|.|.|.||
  Rat   329 PITFRENVAPACLPQK----DWAEATLMTQKTGIVSGFGR-THEKGRQSKVLKMMEVPYVDRNTC 388

  Fly   265 EQQLRLYYGNDFELDNSLMCAGGE-PGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLP 328
                ||  ...|.:..::.|||.: ..:|:|:||.|.|.....||.   |.:.|||::|..|...
  Rat   389 ----RL--STSFSITQNMFCAGYDAKQEDACQGDSGGPHVTRFKDT---YFVTGIVSWGEGCARK 444

  Fly   329 GVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGPY 372
            |...:||.|...::||..:.      :.|......:|.|:..||
  Rat   445 GKYGIYTKVTAFLKWIDRSM------KARVGPTSETPRLTHPPY 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 60/239 (25%)
Tryp_SPc 113..344 CDD:238113 60/239 (25%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 62/250 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.