DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F11

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:233 Identity:73/233 - (31%)
Similarity:114/233 - (48%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDARTSSYVAGGALIAPHVVITAR---QRTENMTASQLVVRAGEWDFSTKTEQLPSV 178
            |.||.|.|  ..|..::.||::|....::||.   ..||  |...|.|..|..:.|...|.  :.
  Rat   398 EWPWQVTL--HTTQGHLCGGSIIGNRWILTAAHCFSGTE--TPKTLRVYGGIVNQSEINED--TT 456

  Fly   179 DVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS-APKNFDFSRCIFTGWGKNSF 242
            ...::.::.|..:.......::||:.|..::..:....|||:|| ..:|...:.|..||||....
  Rat   457 FFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDFQRPICLPSKGDRNVVHTECWVTGWGYTKS 521

  Fly   243 DDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAI 306
            .| ...:.|:|..:|:|....|:.:.|.:     ::.|.::||| .|.|||:|:||.|.||:|  
  Rat   522 RD-EVQSTLQKAKVPLVSNEECQTRYRKH-----KITNKVICAGYKEGGKDTCKGDSGGPLSC-- 578

  Fly   307 KDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.|.. :.|.||.::|..||....|.||||||..::||
  Rat   579 KHNGV-WHLVGITSWGEGCGQKERPGVYTNVAKYVDWI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/231 (31%)
Tryp_SPc 113..344 CDD:238113 71/231 (31%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519
Tryp_SPc 387..615 CDD:214473 71/231 (31%)
Tryp_SPc 388..615 CDD:238113 71/231 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.