DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss15

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:249 Identity:77/249 - (30%)
Similarity:118/249 - (47%) Gaps:49/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALL--DARTSSYVAGGALI-------APHVV------------ITARQRTENMTASQLVVR 162
            ||:|||.  |......:.|.:|:       |.|.|            :.......|:|:.|:|.|
  Rat   801 PWVVALYYRDRSGDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRR 865

  Fly   163 AGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF 227
            .                  :..||.:|.::.....|::|::.|...:..:.:|.|||:|...:.|
  Rat   866 V------------------VDRIVINPHYDKRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQTF 912

  Fly   228 DFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPG 290
            ...| |...|||.|..:..|.::|||:..:|:|....|:|||     .::::..|::||| .|.|
  Rat   913 TPGRMCSIAGWGYNKINAGSTVDVLKEADVPLVSNEKCQQQL-----PEYDITESMLCAGYEEGG 972

  Fly   291 KDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .|||:||.|.||.|  ::| .|:.|.|:.:|||.|.||..|.||..|:..||||
  Rat   973 TDSCQGDSGGPLMC--QEN-NRWFLVGVTSFGVQCALPNHPGVYARVSQFIEWI 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/247 (30%)
Tryp_SPc 113..344 CDD:238113 75/247 (30%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 77/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.