DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:284 Identity:81/284 - (28%)
Similarity:134/284 - (47%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL--LDARTSSYVAGGALIAPHVVITARQRTENMT 155
            ||....|.|....|......||....||:|:|  ...|...:|.||.|:....|:||...|::  
Human    64 CGTAPLKDVLQGSRIIGGTEAQAGAWPWVVSLQIKYGRVLVHVCGGTLVRERWVLTAAHCTKD-- 126

  Fly   156 ASQLVVRAGEWDFSTKTEQL-----PSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHI 215
            ||..::    |.....|..:     .:..:.|::|:.||.|.||:..|::||..|::::..:.:|
Human   127 ASDPLM----WTAVIGTNNIHGRYPHTKKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYI 187

  Fly   216 NPICMPSAPKNFDF-------SRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG 273
            .|||:|     ||.       ::|..:|||:.. ::.:..|:|:...:..:.|..|..: |.|.|
Human   188 QPICLP-----FDVFQILDGNTKCFISGWGRTK-EEGNATNILQDAEVHYISREMCNSE-RSYGG 245

  Fly   274 NDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNV 337
               .:.|:..|||.|.|. |:|.||.|.||.|.:.:. :|:.:.||.::|..||..|.|.||...
Human   246 ---IIPNTSFCAGDEDGAFDTCRGDSGGPLMCYLPEY-KRFFVMGITSYGHGCGRRGFPGVYIGP 306

  Fly   338 ANVIEWIT----------LTTVNM 351
            :...:|:|          :.|:|:
Human   307 SFYQKWLTEHFFHASTQGILTINI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/245 (29%)
Tryp_SPc 113..344 CDD:238113 72/245 (29%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63
Tryp_SPc 78..316 CDD:238113 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.