DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Sp212

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:299 Identity:76/299 - (25%)
Similarity:124/299 - (41%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRLIINEPITDPQ-------------CGFVNSKGVTFSF----REEDTGLAQEAEVPWMVALL-- 125
            |.::...|.|.|.             ||   .:|.|..|    .|...|     :.||:.|:.  
  Fly   241 PAVVTVPPATPPPQRFDPRSQISSVVCG---REGSTTPFIVRGNEFPRG-----QYPWLSAVYHK 297

  Fly   126 DARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVR--- 187
            :.|..::...|:||:..:||:|......||..::||..|.:|.....|.    ...:|:::|   
  Fly   298 EVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGED----GAEMRNVMRLLW 358

  Fly   188 HPGFNLENGAN-NVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT-----GWGKNSFDDPS 246
            ||.:|..:.:: ::||:.:.|.:|.:..|.||||.:.    :.||.:.|     |||::  :|.|
  Fly   359 HPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTV----EASRTVSTTGFIAGWGRD--EDSS 417

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQ 311
            .....:.:...:.....|....|    .....:.|| |||...|...|.||.|..|.....|   
  Fly   418 RTQYPRVVEAEIASPTVCASTWR----GTMVTERSL-CAGNRDGSGPCVGDSGGGLMVKQGD--- 474

  Fly   312 RYELAGIVNFGVDCGLPGV-----PAVYTNVANVIEWIT 345
            |:.|.|||:.| :.|..|.     ..:|.:::..|.||:
  Fly   475 RWLLRGIVSAG-ERGPAGTCQLNQYVLYCDLSKHINWIS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 63/246 (26%)
Tryp_SPc 113..344 CDD:238113 63/246 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 67/260 (26%)
Tryp_SPc 277..511 CDD:214473 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.