DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss43

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:283 Identity:73/283 - (25%)
Similarity:135/283 - (47%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTG-LAQEAEVPWMVALLDARTSSYVAGGAL 138
            :.::..|..:..|.....||        ....|.|.| |:...:.||.|:|  ...:.:|.||:|
Mouse    94 ITLENRRSSLGGPFFTDTCG--------HRITEVDPGSLSAGRKWPWQVSL--QSQNEHVCGGSL 148

  Fly   139 IAPHVVITAR----QRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANN 199
            |:...|:||.    ::.|.|      |..|:....:::|.:..  ||::.|:....|:::...|:
Mouse   149 ISHRWVLTAAHCIYEQEEYM------VMLGDDMLHSESESVTL--VPVQDIIFPSNFDIQTMRND 205

  Fly   200 VALVFLRRSLTSSRHINPICMPSAP---KNFDFSRCIFTGWGKNSFDDPSYMNV-LKKISLPVVQ 260
            :||..|...:..|..|.|:|:|..|   ||  .:.|..||||:.:..|..:.:: |:::...::.
Mouse   206 IALALLYFPVNYSSLIQPVCLPEEPFRVKN--GTVCWVTGWGQQNEIDAGFASILLQEVQQRILL 268

  Fly   261 RRTCEQQLRLYYGNDFEL-DNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD 324
            ::.|....:...|....| ...::|...:.|:..|.||.|:||.|   ::...:...||:::|::
Mouse   269 QKHCNTLFQRQLGTSKNLVIKGMICGLQDSGQSLCWGDSGNPLVC---ESDNTWTQVGIMSWGIN 330

  Fly   325 CGLPGVP--AVYTNVANVIEWIT 345
            |.  |||  :|||::|...||::
Mouse   331 CN--GVPVLSVYTDIAEYNEWVS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/241 (27%)
Tryp_SPc 113..344 CDD:238113 64/241 (27%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97 0/2 (0%)
Tryp_SPc 117..351 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.