DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Egflam

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001276425.1 Gene:Egflam / 268780 MGIID:2146149 Length:1017 Species:Mus musculus


Alignment Length:319 Identity:67/319 - (21%)
Similarity:106/319 - (33%) Gaps:108/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 EWDFSTKTEQ---LPSVDVPIRSIVRHPGFNLENG----ANNVALVFLRRSLTSSRHINPICMPS 222
            |.|.....|:   ||:..|..:.      |::|:.    :|:|....|.:..::|.|...:.:|.
Mouse   267 ELDLDVSFEEVKPLPATKVGNKK------FSVESKKTSVSNSVMGSRLAQPTSASLHETTVAIPP 325

  Fly   223 AP-----KN--------FDFSRCIFTGWGKNSFDDPSY--------MNVLKKISLPVVQRRTCEQ 266
            .|     ||        ||.| |..|....:||....|        .|:.|       ....|.:
Mouse   326 TPAQRKGKNSVAMMSRLFDMS-CDETLCSADSFCVNDYAWGGSRCHCNLGK-------GGEACSE 382

  Fly   267 QLRLYYGNDFELDNSLMCAGGEPGKDS-----------CEGDGGSPLACAIKDNPQR--YELAGI 318
            .:.:.|...|  .:|.:..  ||.|:|           .|.:.|..|.|...::.:.  ..||.|
Mouse   383 DIFIQYPQFF--GHSYVTF--EPLKNSYQAFQVTLEFRAEAEDGLLLYCGESEHGRGDFMSLALI 443

  Fly   319 ---VNFGVDCGLPGVPAVYTNVANVIE--------WITLT----------TVNMPLP-EEREEVP 361
               ::|..:||        |.:|.:|.        |.|:|          .:|...| ..:.:..
Mouse   444 RRSLHFRFNCG--------TGIAIIISETKIKLGAWHTVTLYRDGLNGMLQLNNGTPVTGQSQGQ 500

  Fly   362 YASPTLSAGPYLNQWNQPNYEWL--PTGY---------------PNVNSIPWQLQEANN 403
            |:..|.....||.  ..|:..||  .||.               ..::..||.|.:|.|
Mouse   501 YSKITFRTPLYLG--GAPSAYWLVRATGTNRGFQGCVQSLSVNGKKIDMRPWPLGKALN 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 48/230 (21%)
Tryp_SPc 113..344 CDD:238113 48/230 (21%)
EgflamNP_001276425.1 FN3 36..133 CDD:238020
FN3 142..236 CDD:238020
LamG 391..541 CDD:238058 33/163 (20%)
EGF_CA 560..602 CDD:238011
LamG 618..765 CDD:238058
EGF_CA 790..820 CDD:238011
Laminin_G_2 868..993 CDD:280389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.