DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F7

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:352 Identity:83/352 - (23%)
Similarity:141/352 - (40%) Gaps:78/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QVQAQGQNAELNQSC----GASNEHQCVPRHM-------CKVKIEFRMAMTYRNLGCVSTAICCP 72
            |:....:|.:.:|.|    |......|...::       ||.|:|:         .|....:...
  Rat   129 QLICANENGDCDQYCRDHVGTKRTCSCHEDYVLQPDEVSCKPKVEY---------PCGRIPVVEK 184

  Fly    73 KNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGA 137
            :|....:.|::         .|:|..||                |.||...|  ....:.:.|..
  Rat   185 RNFSRPQGRIV---------GGYVCPKG----------------ECPWQAVL--KFNEALLCGAV 222

  Fly   138 LIAPHVVITARQ------RTENMTASQLVVRAGEWDFSTK--TEQLPSVDVPIRSIVRHPGFNLE 194
            |:....::||..      :..|:|     |..||.|||.|  |||:..|:    .::....:...
  Rat   223 LLDTRWIVTAAHCFDKFGKLVNIT-----VVLGEHDFSEKEGTEQVRLVE----QVIMPNKYTRG 278

  Fly   195 NGANNVALVFLRRSLTSSRHINPICMP------SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKK 253
            ...:::|||.|.|.:|.:.::.|:|:|      :...:..|||  .:|||: ..|..:....|..
  Rat   279 RTDHDIALVRLHRPVTFTDYVVPLCLPERAFSENTLASIRFSR--VSGWGQ-LLDRGATALELMV 340

  Fly   254 ISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAG 317
            |.:|.:..:.|.:..: :..|...:..::.|||...| ||:|:||.|.|.|......   :.|.|
  Rat   341 IEVPRLMTQDCLEHAK-HSANTPRITENMFCAGYMDGTKDACKGDSGGPHATHYHGT---WYLTG 401

  Fly   318 IVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :|::|..|...|...|||.|:..|:|:
  Rat   402 VVSWGEGCAAIGHIGVYTRVSQYIDWL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/245 (27%)
Tryp_SPc 113..344 CDD:238113 65/245 (27%)
F7NP_690059.1 GLA 25..85 CDD:214503
EGF_CA 87..123 CDD:238011
Tryp_SPc 194..430 CDD:238113 70/278 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.