DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and KLK5

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:235 Identity:68/235 - (28%)
Similarity:114/235 - (48%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            ||..||| .|.:....|..|:.|..::||....:.:    ..||.|.:..|...|....:...::
Human    79 PWQAALL-LRPNQLYCGAVLVHPQWLLTAAHCRKKV----FRVRLGHYSLSPVYESGQQMFQGVK 138

  Fly   184 SIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI-----CMPSAPKNFDFSRCIFTGWGKNSFD 243
            || .|||::....:|::.|:.|.|.:..::.:.||     | |||.     ::|:.:|||.....
Human   139 SI-PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHC-PSAG-----TKCLVSGWGTTKSP 196

  Fly   244 DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKD 308
            ...:..||:.:::.|:.::.||..    |..  ::|:::.|||.:.|:|||:||.|.|:.|    
Human   197 QVHFPKVLQCLNISVLSQKRCEDA----YPR--QIDDTMFCAGDKAGRDSCQGDSGGPVVC---- 251

  Fly   309 NPQRYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWITLT 347
               ...|.|:|::| ..|..|..|.||||:....:||..|
Human   252 ---NGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQET 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/230 (28%)
Tryp_SPc 113..344 CDD:238113 65/230 (28%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68
Tryp_SPc 66..285 CDD:214473 65/230 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.