DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Plau

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:243 Identity:77/243 - (31%)
Similarity:111/243 - (45%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALL----DARTSSYVAGGALIAPHVVITARQRTENM-TASQLVVRAGEWDFSTKTEQLP-S 177
            ||..|:.    .....|:..||:||:|..|.:|.....|. ...:.||..|:   |.:....| .
  Rat   191 PWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQ---SKRNSYNPGE 252

  Fly   178 VDVPIRSIVRHPGFNLENGA--NNVALVFLRRS----LTSSRHINPICMP----SAPKNFDFSRC 232
            :...:..::.|..|:.|..|  |::||:.:|.|    ...||.|..||:|    .||...|   |
  Rat   253 MKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTICLPPRFGDAPFGSD---C 314

  Fly   233 IFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEG 296
            ..||:|:.|..|..|...||...:.::....|:|.  .|||:  |::..::||.....| |||.|
  Rat   315 EITGFGQESATDYFYPKDLKMSVVKIISHEQCKQP--HYYGS--EINYKMLCAADPEWKTDSCSG 375

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.|.||.|.|...|   .|:|||::|..|.....|.|||.|:..:.||
  Rat   376 DSGGPLICNIDGRP---TLSGIVSWGSGCAEKNKPGVYTRVSYFLNWI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/241 (31%)
Tryp_SPc 113..344 CDD:238113 75/241 (31%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056
Connecting peptide 152..178
Tryp_SPc 178..420 CDD:214473 75/241 (31%)
Tryp_SPc 179..423 CDD:238113 77/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.