DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Klkb1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:258 Identity:74/258 - (28%)
Similarity:126/258 - (48%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGLAQEA--EVPWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENM 154
            |..|.|...|........|....:  |.||.|:| :...:.:::.||::|....::||....:.:
  Rat   375 CKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGI 439

  Fly   155 TASQL-VVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI 218
            ....: .:..|..:.|..|.:.|...  |:.::.|..:.:..|:.::||:.|:..|..:....||
  Rat   440 PYPDVWRIYGGILNLSEITNKTPFSS--IKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPI 502

  Fly   219 CMPS-APKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSL 282
            |:|| |..|..::.|..||||... :.....|:|:|.::|:|....|:::.|     |:.:...:
  Rat   503 CLPSKADTNTIYTNCWVTGWGYTK-ERGETQNILQKATIPLVPNEECQKKYR-----DYVITKQM 561

  Fly   283 MCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :||| .|.|.|:|:||.|.||.|   .:..|::|.||.::|..|.....|.|||.||..|:||
  Rat   562 ICAGYKEGGIDACKGDSGGPLVC---KHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/236 (28%)
Tryp_SPc 113..344 CDD:238113 67/236 (28%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 74/258 (29%)
Tryp_SPc 390..621 CDD:214473 68/241 (28%)
Tryp_SPc 391..621 CDD:238113 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.