DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG30289

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:292 Identity:72/292 - (24%)
Similarity:122/292 - (41%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IINEPITDPQCGFVNSKGVTFSFREEDTGLAQE---------------AEVPWMVALLDARTSSY 132
            :||..|....|.|:.:..|......|:.|::::               .|.||||.:    .||.
  Fly     3 VINAVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLV----WSSK 63

  Fly   133 VAGGALIAPHVVITARQRTENMTASQLVVRAGEWD------FSTKTEQLP-----SVDVPIRSIV 186
            ..||:|||...|:||   ...::...|.||.|:::      :......:|     |||:.|    
  Fly    64 PCGGSLIARQFVLTA---AHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKI---- 121

  Fly   187 RHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVL 251
            .|..:|.....|::||:.:..::..|.::.|||:....:.........||||:..:.  .:..:|
  Fly   122 VHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEYG--QFSRIL 184

  Fly   252 KKISLPVVQRRTCEQQLRLYYGN---DFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRY 313
            ...:|         ..:.:.|.|   :.:.|.|.:|||... .::|:||.|.||:.......:..
  Fly   185 LNATL---------YNMDISYCNIKFNKQADRSQICAGSHT-SNTCKGDSGGPLSSKFHYGNRLL 239

  Fly   314 ELA-GIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ... |:|::|.:.....|..|||||:...|||
  Fly   240 SFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/260 (24%)
Tryp_SPc 113..344 CDD:238113 62/260 (24%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 62/251 (25%)
Tryp_SPc 42..271 CDD:238113 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.