DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG30087

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:299 Identity:87/299 - (29%)
Similarity:132/299 - (44%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGL----AQEAEV---PWMVALL 125
            |||     :|::.| |::....:|.|      |||:   |..|.:    .:||.:   |:||.: 
  Fly    11 AIC-----LIRQQR-IVDAQFLNPLC------GVTY---ESQTAMRVVNGKEAVIRSAPFMVYV- 59

  Fly   126 DARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTE------QLPSVDVPIRS 184
             ...|....||:::....::||    .:.....|.:|.||.:..|..:      ...|.:..|..
  Fly    60 -TNNSLTHCGGSILNSRYILTA----AHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMK 119

  Fly   185 IVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM----PSAPKNFDFSRCIFTGWG---KNSF 242
            .:.|..:|..|..|::||:.|.||:..:.||.|||:    .|||....:..   .|||   ||.|
  Fly   120 AITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQT---FGWGETKKNGF 181

  Fly   243 DDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIK 307
            .     ::|:...|.......|.:....|      ::.:.:|||.|. :|:|.||.|.||...:.
  Fly   182 P-----HLLQTAELRAYDAAYCSRSFHAY------MNGNQICAGHEE-RDTCAGDSGGPLVTRVD 234

  Fly   308 -DNPQRYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWI 344
             |..:||...|||::| .||..||   |||.|.|.|.||
  Fly   235 FDGVKRYLQLGIVSYGPTDCQSPG---VYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/248 (29%)
Tryp_SPc 113..344 CDD:238113 72/248 (29%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 72/252 (29%)
Tryp_SPc 42..272 CDD:238113 74/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.