DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Cela2a

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:268 Identity:80/268 - (29%)
Similarity:133/268 - (49%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGL--AQEAEV---PWMVAL--LDARTSSYVAGGALIAPHVVITARQR 150
            ||:     .|:..:.:.:.:  .|||..   ||.|:|  |.:....:..||:|:|.:.|:||...
  Rat    17 CGY-----PTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNWVLTAAHC 76

  Fly   151 TENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFN---LENGANNVALVFLRRSLTSS 212
            ..|....::::..    .|..|.:..|:.|.:..:|.|..:|   |.|| |::|||.|...:..:
  Rat    77 ISNSRTYRVLLGR----HSLSTSESGSLAVQVSKLVVHEKWNAQKLSNG-NDIALVKLASPVALT 136

  Fly   213 RHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG 273
            ..|...|:|.|    |.|:.   |..||||:...:..: .:||::..|.||...||..  ..::|
  Rat   137 SKIQTACLPPAGTILPNNYP---CYVTGWGRLQTNGAT-PDVLQQGRLLVVDYATCSS--ASWWG 195

  Fly   274 NDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFG--VDCGLPGVPAVYTN 336
            :  .:..:::||||:....||.||.|.||.|...:.  ::::.|||:||  :.|..|..|:|:|.
  Rat   196 S--SVKTNMVCAGGDGVTSSCNGDSGGPLNCQASNG--QWQVHGIVSFGSTLGCNYPRKPSVFTR 256

  Fly   337 VANVIEWI 344
            |:|.|:||
  Rat   257 VSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/244 (31%)
Tryp_SPc 113..344 CDD:238113 75/244 (31%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 75/248 (30%)
Tryp_SPc 31..267 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.