DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss42

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:246 Identity:73/246 - (29%)
Similarity:131/246 - (53%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            |:|.:.||.|::  .....:|.||:||....|:||....  .:..|..|:.|:   .:...|..|
Mouse    85 AEEGKWPWQVSV--RVRHMHVCGGSLINSQWVLTAAHCI--YSRIQYNVKVGD---RSVYRQNTS 142

  Fly   178 VDVPIRSIVRHPGFNLENGA-NNVALVFLRRSLTSSRHINPICMPSAPKNFDF---SRCIFTGWG 238
            :.:||::|..||.|:..... |::||:.|:..:..:.:|.|:|:||  ::|..   ::|..||||
Mouse   143 LVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPS--ESFPVKAGTKCWVTGWG 205

  Fly   239 K---NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFEL-DNSLMCAGGEPGKDSCEGDGG 299
            |   .:.|.|:  .:|:::...|:....|.:.|:....:..:| ...::|...|.|||:|:||.|
Mouse   206 KLVPGAPDVPT--EILQEVDQNVILYEECNEMLKKATSSSVDLVKRGMVCGYKERGKDACQGDSG 268

  Fly   300 SPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVN 350
            .|::|..::   ::...|:|::|:.||..|.|.|||:||...:|: :..||
Mouse   269 GPMSCEFEN---KWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWL-IAVVN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/238 (29%)
Tryp_SPc 113..344 CDD:238113 70/238 (29%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 70/237 (30%)
Tryp_SPc 79..310 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.