DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F10

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:257 Identity:61/257 - (23%)
Similarity:116/257 - (45%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSV 178
            ::.|.||...|::.....: .||.:::...::||....  ..|.:..||.|  |.:|:.|:....
Human   242 KDGECPWQALLINEENEGF-CGGTILSEFYILTAAHCL--YQAKRFKVRVG--DRNTEQEEGGEA 301

  Fly   179 DVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRC--------IFT 235
            ...:..:::|..|..|....::|::.|:..:|...::.|.|:|..    |::..        |.:
Human   302 VHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPER----DWAESTLMTQKTGIVS 362

  Fly   236 GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGE-PGKDSCEGDGG 299
            |:|: :.:.......||.:.:|.|.|.:|:      ..:.|.:..::.|||.: ..:|:|:||.|
Human   363 GFGR-THEKGRQSTRLKMLEVPYVDRNSCK------LSSSFIITQNMFCAGYDTKQEDACQGDSG 420

  Fly   300 SPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVP 361
            .|.....||.   |.:.|||::|..|...|...:||.|...::||..:.....||:.:...|
Human   421 GPHVTRFKDT---YFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/238 (24%)
Tryp_SPc 113..344 CDD:238113 56/238 (24%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 58/240 (24%)
O-glycosylated at one site 476..485 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.