DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss13

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:425 Identity:108/425 - (25%)
Similarity:164/425 - (38%) Gaps:120/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIAIVSLILVAGQVQAQGQNA---------------ELNQSCGASNEHQCVPRHM--------CK 48
            |..::||||:.|..:.|....               |..:||         |.|.        ||
Mouse   157 ISLVISLILLYGGRETQSPRGTAVYFWRGHTGIKYKEPLESC---------PIHAVRCDGVVDCK 212

  Fly    49 VKIEFRMAMTYRNLGCVS------------------TAIC------------CPK---------- 73
            :|.:        .||||.                  ..:|            |.:          
Mouse   213 MKSD--------ELGCVRFDWDKSLLKVYSGSSGEWLPVCSSSWNDTDSKRTCQQLGFDSAYRTT 269

  Fly    74 ---------NLIIKEPRLIINEPITDPQC---GFVNSKGVTFSFREEDTG------LAQEAEVPW 120
                     :.::.|....|.|.:...||   .:|:.:......|.. ||      |..|::.||
Mouse   270 EVAHRDITSSFLLSEYNTTIQESLYRSQCPSRRYVSLQCSHCGLRAM-TGRIVGGALTSESKWPW 333

  Fly   121 MVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLV----VRAGEWDFSTKTEQLPSVDVP 181
            .|:|....|  ::.||.||....|:|| .....:|..:|:    |.||    ::...|||.. ..
Mouse   334 QVSLHFGTT--HICGGTLIDAQWVLTA-AHCFFVTREKLLEGWKVYAG----TSNLHQLPEA-AS 390

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR-CIFTGWGKNSFDDP 245
            |..|:.:..:..|....::||:.|.:.||.|.||:|.|:|...:.|..:. |..||:||....|.
Mouse   391 ISQIIINGNYTDEQDDYDIALIRLSKPLTLSAHIHPACLPMHGQTFGLNETCWITGFGKTKETDE 455

  Fly   246 SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDN 309
            .....|:::.:.::..:.|...| :|   |..|...:||||. ..|:|||:||.|.||.|   :.
Mouse   456 KTSPFLREVQVNLIDFKKCNDYL-VY---DSYLTPRMMCAGDLRGGRDSCQGDSGGPLVC---EQ 513

  Fly   310 PQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ..|:.|||:.::|..||....|.|||.|..|:.||
Mouse   514 NNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWI 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/236 (32%)
Tryp_SPc 113..344 CDD:238113 75/236 (32%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060 4/23 (17%)
SRCR_2 225..314 CDD:373897 8/88 (9%)
Tryp_SPc 319..548 CDD:214473 76/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.