DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss7

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:303 Identity:83/303 - (27%)
Similarity:137/303 - (45%) Gaps:40/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNLGCVSTAICCPKNLIIKEPRL----IINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPW 120
            |::.|.|....|..::..::...    |::.|....:.|...|:..:|..|......:||...||
Mouse   541 RSIPCTSRTFKCGNDICFRKQNAQCDGIVDCPDGSDEEGCGCSRSSSFLHRIVGGSDSQEGTWPW 605

  Fly   121 MVALLDARTSSYVAGGALIAPHVVITAR-----QRTEN---MTASQLVVRAGEWDFSTKTEQLPS 177
            .|:|  ....|...|.::|:...:::|.     .|..:   .||...:...|...|.:       
Mouse   606 QVSL--HFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFIS------- 661

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSL----TSSRHINPICMPSA-PKNFDFSRCIFTGW 237
               |:|.||.|..:|.:....::||  |:.|:    |..:.|.|||:|.| .|.....:|..|||
Mouse   662 ---PVRRIVVHEYYNSQTFDYDIAL--LQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTGW 721

  Fly   238 GKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSP 301
            |:....|.....||::..:.::.:..|...    ||   .:.:.::|||...|| |:|:||.|.|
Mouse   722 GRRHEADSKGSPVLQQAEVELIDQTVCVST----YG---IITSRMLCAGVMSGKSDACKGDSGGP 779

  Fly   302 LACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |:|..|.: .::.|.|||::|..||.|..|.|||.|::.:.||
Mouse   780 LSCRRKSD-GKWILTGIVSWGHGCGRPNFPGVYTRVSSFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/244 (29%)
Tryp_SPc 113..344 CDD:238113 71/244 (29%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 5/34 (15%)
Tryp_SPc 591..821 CDD:214473 72/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.