DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Proc

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:325 Identity:83/325 - (25%)
Similarity:146/325 - (44%) Gaps:52/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGASNEHQCVPRHM-CKVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFV 96
            |..:..::....|| ||..:.|......|.:.        .|..|:|....:.:|...||:  .|
Mouse   183 CACAPGYELADDHMRCKSTVNFPCGKLGRWIE--------KKRKILKRDTDLEDELEPDPR--IV 237

  Fly    97 NSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVV 161
            |..            |.::.:.||...|||:: .....||.||....|:||....|.  ..:|.|
Mouse   238 NGT------------LTKQGDSPWQAILLDSK-KKLACGGVLIHTSWVLTAAHCVEG--TKKLTV 287

  Fly   162 RAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKN 226
            |.||:|...:...  .:|:.|:.|:.||.:...:..|::||:.|.:..|.|:.|.|||:|:....
Mouse   288 RLGEYDLRRRDHW--ELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLA 350

  Fly   227 FDFSRC----IFTGWG------KNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNS 281
            .:.::.    :.||||      |:...:.::  :|..|.:|:|.|..|.:.::..      :..:
Mouse   351 QELTQAGQETVVTGWGYQSDRIKDGRRNRTF--ILTFIRIPLVARNECVEVMKNV------VSEN 407

  Fly   282 LMCAG--GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ::|||  |:. :|:|:||.|.|:....:..   :.|.|:|::|..||......:||.|.:.::||
Mouse   408 MLCAGIIGDT-RDACDGDSGGPMVVFFRGT---WFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWI 468

  Fly   345  344
            Mouse   469  468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/242 (27%)
Tryp_SPc 113..344 CDD:238113 65/242 (27%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209 3/14 (21%)
Tryp_SPc 236..470 CDD:238113 70/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.