DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and PRSS36

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:314 Identity:88/314 - (28%)
Similarity:130/314 - (41%) Gaps:65/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDF--------- 168
            ||....||.|:|  .....::.||:||||..|::|....  ||...| ..|.||..         
Human    53 AQPGTWPWQVSL--HHGGGHICGGSLIAPSWVLSAAHCF--MTNGTL-EPAAEWSVLLGVHSQDG 112

  Fly   169 ---STKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DF 229
               ...|..:.::.||...      ..:|.|| ::||:.|....:....:.|:|:|.|...| ..
Human   113 PLDGAHTRAVAAIVVPANY------SQVELGA-DLALLRLASPASLGPAVWPVCLPRASHRFVHG 170

  Fly   230 SRCIFTGWGKNSFDDPSYMN-VLKKISLPVVQRRTCEQQLRLY-----YGNDFELDNSLMCAGGE 288
            :.|..||||.....||..:. ||:::.|.::...||:   .||     :....::...::|||..
Human   171 TACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQ---CLYSQPGPFNLTLQILPGMLCAGYP 232

  Fly   289 PG-KDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMP 352
            .| :|:|:||.|.||.|   :...|:..|||.:||..||....|.|:|.||....||        
Human   233 EGRRDTCQGDSGGPLVC---EEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI-------- 286

  Fly   353 LPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYPNVNSIPWQLQEANNDLA 406
                ||:|..:.|    ||.           .||......|.|.:.:|.|..:|
Human   287 ----REQVMGSEP----GPA-----------FPTQPQKTQSDPQEPREENCTIA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/250 (29%)
Tryp_SPc 113..344 CDD:238113 73/250 (29%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 73/250 (29%)
Tryp_SPc 47..289 CDD:238113 76/265 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 7/38 (18%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.