DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP001415

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_321719.5 Gene:AgaP_AGAP001415 / 1281762 VectorBaseID:AGAP001415 Length:887 Species:Anopheles gambiae


Alignment Length:320 Identity:63/320 - (19%)
Similarity:96/320 - (30%) Gaps:108/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIVS----LILV--AGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVST 67
            |::|    |::|  :|::|.:|..|:..............|...|        :.|||     ||
Mosquito   394 AVISDGPRLVMVFSSGELQGRGFKAKYTFETEYKIPGTAAPDGTC--------SFTYR-----ST 445

  Fly    68 AICCPKNLIIKEPRLIINEPITDPQCGFV----NSKGVTFSFRE--------EDTGLAQEAEV-- 118
            :   .|......||...|.| ::..|.:|    .::.||..|..        ..||.|..|.|  
Mosquito   446 S---RKKGEFNSPRYPSNYP-SETNCSYVFLATPNEQVTIVFDHFKVKADGANTTGGAYGASVCF 506

  Fly   119 -PWM---VALLD------ARTSSYVAGGALIAPH----VVITARQRTENMTASQLVVRAGEWDFS 169
             .|:   |...|      .|..|..|.|.:.:|.    :.:......||: ||....|   :.|.
Mosquito   507 EDWLEMYVLYRDGTDRFLGRYCSLTAPGPVESPRGAVGIRVVLHTDLENV-ASGFKAR---YIFE 567

  Fly   170 TKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF 234
            |           .:|:....|.|.....:.:                 :..|:.|.|:|      
Mosquito   568 T-----------AKSVFGDCGGNFSGEDSGI-----------------VTSPNFPANYD------ 598

  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
             |.||.                  :..|.|...:....|....|:.......|||....|
Mosquito   599 -GPGKG------------------LASRACNWYITARIGYKILLNFDYFAIEGEPATRGC 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 36/198 (18%)
Tryp_SPc 113..344 CDD:238113 36/198 (18%)
AgaP_AGAP001415XP_321719.5 CUB 27..142 CDD:238001
CUB 159..271 CDD:238001
CUB 303..422 CDD:238001 8/27 (30%)
CUB 438..566 CDD:238001 34/148 (23%)
CUB 576..699 CDD:238001 17/106 (16%)
LDLa 718..754 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.