DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP001964

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_321098.5 Gene:AgaP_AGAP001964 / 1281159 VectorBaseID:AGAP001964 Length:363 Species:Anopheles gambiae


Alignment Length:280 Identity:107/280 - (38%)
Similarity:149/280 - (53%) Gaps:11/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CCPKNLIIKEPRLIINEPITDPQ--CGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDART--S 130
            |||...|::.|.   .|...:.:  |...|:.|:. ...::|...|:..|.|||..:..|:.  .
Mosquito    76 CCPFERIVRAPD---TEAPDEAEIVCAARNNNGIG-HVEQKDKTRAKYGEFPWMAFVYTAQADYE 136

  Fly   131 SYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLEN 195
            .|:.||.|:...||||.....||.|||:|.||.||||.....|..|..|..:.:.|.||.|..|.
Mosquito   137 LYLCGGTLVHSKVVITIAHCIENRTASELRVRLGEWDLEHMVEIYPPQDRAVIAAVTHPQFYSEL 201

  Fly   196 GANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQ 260
            ..|::|::||...:..:..:...|:|....|||..||:|||||::.....|  :|||:..||:|.
Mosquito   202 LLNDIAILFLDEHVDFTEVVGIACLPPQNANFDHKRCLFTGWGEDERGRNS--SVLKRTKLPIVP 264

  Fly   261 RRTCEQQLRLYYGN-DFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD 324
            ...|::.||.:..| .|.|....:|||||.|||:|.|||||||.|.|..:..:|.:.|:|.||.:
Mosquito   265 NGQCQRVLRRHLLNRSFRLHQGFLCAGGESGKDACRGDGGSPLVCPIPQSENQYYVVGLVAFGYE 329

  Fly   325 CGLPGVPAVYTNVANVIEWI 344
            ||..|||.||.||.:..:||
Mosquito   330 CGTQGVPGVYVNVPHYRDWI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 95/233 (41%)
Tryp_SPc 113..344 CDD:238113 95/233 (41%)
AgaP_AGAP001964XP_321098.5 Tryp_SPc 117..350 CDD:238113 97/235 (41%)
Tryp_SPc 117..349 CDD:214473 95/233 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.