DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:253 Identity:71/253 - (28%)
Similarity:104/253 - (41%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TSSYVAGGALIAPHVVITARQ--RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGF 191
            |..:..||:||..:.::||..  ...:...|..|:|.|:.:.....:.....:..|..|:|||..
Mosquito    44 TVQWKCGGSLIWENYILTAAHCYADPDTILSPDVIRIGDLNLFDADDDEFVQERKIVQIIRHPLH 108

  Fly   192 NLENGANNVALVFLRRSLTSSRHINPICM---PSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKK 253
            |......::||:.|.:.:..|..:.|.|:   .|.|    ||.....|||:..|.... .|:|.|
Mosquito   109 NASTVYYDLALLKLDKKVIQSEGVIPTCLWLDDSIP----FSTLEVAGWGQTGFGKEK-SNMLLK 168

  Fly   254 ISLPVVQRRTCEQ------QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQR 312
            ..|.::....|.:      |.||  |||  |.:..:||..|. .|:|.||.|.||         .
Mosquito   169 AELKLMTNTECAKYNNKRTQRRL--GND--LADHQLCAWDEV-MDTCPGDSGGPL---------H 219

  Fly   313 YE----------LAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEV 360
            |.          |.|:.:||..|.: ..|.||..||...:||..|     |.|:.|:|
Mosquito   220 YNLYYKHTKIPFLVGVTSFGKACAV-SQPGVYVKVAKFKQWIIET-----LQEQGEQV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/235 (27%)
Tryp_SPc 113..344 CDD:238113 64/235 (27%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 66/238 (28%)
Tryp_SPc 19..260 CDD:214473 64/235 (27%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.