DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:132 Identity:64/132 - (48%)
Similarity:85/132 - (64%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 INPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNV-LKKISLPVVQRRTCEQQLR-LYYGNDFE 277
            :|.||:|.|...||..||:.:||||:.|.:...:.| :||:.||:|.|..|::.|| .:.|..|:
Mosquito     4 VNTICLPPADYIFDPVRCVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGRQFK 68

  Fly   278 LDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIE 342
            |..|.:|||||.|:|:|:|||||||.|.|......|..||||.:|:|||..|:|.||.|||...|
Mosquito    69 LHESFVCAGGEKGRDTCKGDGGSPLVCPIPGVANGYYQAGIVAWGIDCGKEGIPGVYVNVALFRE 133

  Fly   343 WI 344
            ||
Mosquito   134 WI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/130 (48%)
Tryp_SPc 113..344 CDD:238113 62/130 (48%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 64/132 (48%)
Tryp_SPc <2..135 CDD:214473 62/130 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.