DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:287 Identity:73/287 - (25%)
Similarity:122/287 - (42%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVI 145
            ||::.....|  ||:..:..:.      ...:|...|...||.|||..|.:....||:|:...|:
Mosquito   136 RLVVQPQECD--CGWSRTAKIV------GGSVAGVNEYTAMVGLLDPLTVNVFCSGAIISSRYVL 192

  Fly   146 TARQRTENM-TASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSL 209
            ||......: :.|::....|:.|:.:..:...|....|..|:.|..:|.:...|::||:.....:
Mosquito   193 TAAHCARTIPSVSRVQALVGDHDYRSGLDTPYSAIYNIEQIISHEYYNEQTRNNDIALLKTSTEM 257

  Fly   210 TSSRHINPICMPSAPKNFDFS--RCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYY 272
            ..:|.:.|||:|.....:.|.  .....|||..||..| ...:|:|.:|.|:|...|...    |
Mosquito   258 DFNRGVGPICLPFTYSTYSFGGLSVDIAGWGTTSFGGP-MSTILRKTTLNVLQNANCTAP----Y 317

  Fly   273 GNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNV 337
            .||.::....:      |:|||:.|.|.  |..::.:.:.|.: ||:::|..|. ...|:|.|.|
Mosquito   318 VNDQKICTFAV------GRDSCQYDSGG--ALFLRGSQRMYSI-GIISYGSACA-ASTPSVATRV 372

  Fly   338 ANVIEWITLTTVNMPLPEEREEVPYAS 364
            ...:.||...|         .||.|.:
Mosquito   373 TAYLSWIRQNT---------PEVSYCA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/233 (27%)
Tryp_SPc 113..344 CDD:238113 62/233 (27%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 62/246 (25%)
Tryp_SPc 154..382 CDD:238113 64/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.