DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP012328

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_320219.3 Gene:AgaP_AGAP012328 / 1280372 VectorBaseID:AGAP012328 Length:324 Species:Anopheles gambiae


Alignment Length:285 Identity:81/285 - (28%)
Similarity:124/285 - (43%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KGVTF---SFREEDTGLAQEAEV-----------PWMVAL--LDAR--TSSYVAGGALIAPHVVI 145
            ||:|.   |..:|..|:..:..:           |||..|  ::.|  |..:..||||:....|:
Mosquito    41 KGLTCRTGSVNDEVCGVQMDNRIVGGQRTSIDQYPWMALLQYINHRKGTKRFACGGALLNRKFVL 105

  Fly   146 TARQRTENMTASQLV--VRAGEWDFSTK--TEQL--------PSVDVPIRSIVRHPGF--NLENG 196
            :|......:.|...:  ||.||||..::  .|.|        |..|:....|:.|.|:  |..:.
Mosquito   106 SAAHCFVRLPAGVELHKVRLGEWDTDSEIDCEDLDDELSCASPVQDLDYERIIIHEGYTGNHADR 170

  Fly   197 ANNVALVFLRRSLTSSRHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLP 257
            .|::||:.|..|...:..:.|||:|..    .:...|......|||:......|...:.  :.|.
Mosquito   171 ENDIALIELSGSAKYNDFVKPICLPEPGTPNKEKLYFGSMWAAGWGRTETASGSRFKLY--VPLD 233

  Fly   258 VVQRRTCEQ--QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVN 320
            :...::|.:  |.|:    ...|..:..||.|.||||:|.||.|.||   :|.....:.:.|:|:
Mosquito   234 LFDLQSCNETYQRRV----KVPLTETQFCAMGTPGKDTCNGDSGGPL---MKTMKTLHYVVGVVS 291

  Fly   321 FGVD-CGLPGVPAVYTNVANVIEWI 344
            ||.. || .|:|||||.|....:||
Mosquito   292 FGPQRCG-SGIPAVYTRVDKFYDWI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/266 (27%)
Tryp_SPc 113..344 CDD:238113 73/266 (27%)
AgaP_AGAP012328XP_320219.3 CLIP 1..45 CDD:295450 2/3 (67%)
Tryp_SPc 62..315 CDD:214473 73/262 (28%)
Tryp_SPc 63..315 CDD:238113 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.