DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP008999

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_319748.4 Gene:AgaP_AGAP008999 / 1279959 VectorBaseID:AGAP008999 Length:190 Species:Anopheles gambiae


Alignment Length:161 Identity:46/161 - (28%)
Similarity:74/161 - (45%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EDTGLAQEAEVPWM--VALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFST 170
            :|.|.   ...||.  :.:..:|:.....||:||:...|:||.......|..|:.|..|::..::
Mosquito    35 DDAGF---GSFPWQAYIRIGSSRSMLSRCGGSLISRRHVVTAGHCVARATPRQVHVTLGDYVINS 96

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGAN--NVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCI 233
            ..|.||:....:|:|..||.|.....|:  :||::.|.|::....||.|||:|.  ||.||....
Mosquito    97 AVEPLPAYTFGVRTINVHPYFKFTPQADRFDVAVLTLERTVHFMPHIAPICLPE--KNEDFLGKF 159

  Fly   234 --FTGWGKNSFDDPSYMNVLKKISLPVVQRR 262
              ..|||..:.........|:.:.:||:..|
Mosquito   160 GWAAGWGALNPGSRLRPKTLQAVDVPVLDNR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 44/156 (28%)
Tryp_SPc 113..344 CDD:238113 44/156 (28%)
AgaP_AGAP008999XP_319748.4 Tryp_SPc 30..>190 CDD:214473 45/159 (28%)
Tryp_SPc 31..>190 CDD:238113 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.