DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG43336

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:115/275 - (41%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DPQCGF-VNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITAR----Q 149
            |..||. .:|..|.   |.::..:|.....||| |.|.:....::.||:||...:|:||.    .
  Fly    23 DMACGIRAHSPSVP---RVKNGTVASLTSSPWM-AFLHSTDGRFICGGSLITNRLVLTAAHCFLD 83

  Fly   150 RTENMTASQLVVRAGEWDFSTKTEQLP---------SVDVPIRSIVRHPGFNLENGANNVALVFL 205
            |||      ||.|.||:|    .|:..         .::..:....||..:|....|.::|::.|
  Fly    84 RTE------LVARLGEYD----REEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRL 138

  Fly   206 RRSLTSSRHINPICM---PSAPKNFD-FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQ 266
            .|.:..:.:|.|||:   |...|..| ......|||||...:..|..  |:.:.|.......|.:
  Fly   139 YRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAK--LRTVDLARKHPEVCRR 201

  Fly   267 QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIK-DNPQRYELAGIVNF-GVDCGLPG 329
            ...|      .|..:..|||.| ..:.|.||.|.|:...|. ...:|:...||.:| ...|.:  
  Fly   202 YATL------SLTANQFCAGNE-RSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVM-- 257

  Fly   330 VPAVYTNVANVIEWI 344
             .:|:|:|.:.::||
  Fly   258 -VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/249 (27%)
Tryp_SPc 113..344 CDD:238113 66/249 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 67/256 (26%)
Tryp_SPc 40..271 CDD:238113 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.