DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG43335

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:126/293 - (43%) Gaps:45/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGGALIA 140
            |.||:      :|.||.....    ||.........:||:   |||..|.:  ...|...|.||.
  Fly    21 ESRLL------EPNCGIRTMP----SFHRTRIIGGSDAEITSHPWMAYLYN--EFHYFCAGTLIT 73

  Fly   141 PHVVITARQRTENMTASQLVVRAGEWDFSTKTE----QLPSVDVPIRSIVRHPGFNLENGANNVA 201
            ...|:||....|  .:..|.||.|.... |:::    |:.:.|..:...::|..|......|::|
  Fly    74 NQFVLTAAHCIE--ASKNLTVRLGGSGL-TRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIA 135

  Fly   202 LVFLRRSLTSSRHINPICMPSAPK----NFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRR 262
            ::.|.|::....||.|||:...|.    ..|....:.||||  ..|...:.::|::..:.|:.|.
  Fly   136 MIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWG--LADKRMHPHLLQEAPITVMNRN 198

  Fly   263 TCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIK-DNPQRYELAGIVNFG-VDC 325
            .|.   :||   |..:....:|| |:...::|.||.|.||...:. ....|:...||.:|| ::|
  Fly   199 VCS---KLY---DVAITQGQICA-GDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIEC 256

  Fly   326 GLPGVPAVYTNVANVIEWITLTTVNMPLPEERE 358
               ..|::||:::....||     ||.:.:.|:
  Fly   257 ---RSPSIYTDLSTYSGWI-----NMVVSQYRK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/243 (26%)
Tryp_SPc 113..344 CDD:238113 64/243 (26%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 64/247 (26%)
Tryp_SPc 42..275 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.