DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG43110

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:109/237 - (45%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            |.:....:|..:.:  |:..:.||.:|....|:|........|   |.||.|.::.:..|:|:..
  Fly    42 ASQQSAQYMAGIFN--TTHLLCGGTIIHEDFVLTVAHCKSTQT---LFVRLGAYNINHPTDQIRV 101

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM---PSAPKNFDFSRCIFTGWGK 239
            ::.     :.||.::....||::|||.|.||:..:.:|.|||:   .:..|...:....  |||:
  Fly   102 IET-----IAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYNAF--GWGR 159

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLAC 304
            ....:.|  ::|::|.:    .||......||.|  ...|...:||..:.| |:|.||.|.||..
  Fly   160 TRNAEQS--DILQRIFV----NRTNPMICHLYLG--MSPDPKQICATTDQG-DTCAGDSGGPLIS 215

  Fly   305 AIKDNPQRYELA-GIVNFGV-DCGLPGVPAVYTNVANVIEWI 344
            .|....:.::.. ||.::|. :|.  || .:||:|:....||
  Fly   216 KITYQGKNFDTQFGITSYGTRECN--GV-GLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/235 (26%)
Tryp_SPc 113..344 CDD:238113 62/235 (26%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 62/235 (26%)
Tryp_SPc 36..257 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.