DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG43125

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:261 Identity:62/261 - (23%)
Similarity:104/261 - (39%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FREEDTGLAQE-AEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDF 168
            |.|::.|.:.. :..||:|.:....:|:....|.||....|:||....:..|  :|:||.||.|.
  Fly    22 FLEQNCGKSSVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQT--ELIVRLGEIDG 84

  Fly   169 STK-TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPIC-------MPSAPK 225
            :.: :.:|...::.:...:.|..::.|:...|:||:.|:.|:...::|.|||       :|.|| 
  Fly    85 TLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAP- 148

  Fly   226 NFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEP 289
            .|:..        |...::|      ||....:::|          :.|.|     |...| .||
  Fly   149 TFEIE--------KKKNEEP------KKNKAGIMKR----------FLNWF-----LSLFGVREP 184

  Fly   290 GKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGV----------DCGLPGVPAVYTNVANVIEWI 344
            ..|.....  .|:|.......|..|.|....:|:          |        |||:|...:.||
  Fly   185 RPDVILPP--QPIAVGWPLTKQINESALFHQYGILSHRNSESKKD--------VYTDVMAYVNWI 239

  Fly   345 T 345
            |
  Fly   240 T 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/250 (22%)
Tryp_SPc 113..344 CDD:238113 56/250 (22%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.