DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:273 Identity:79/273 - (28%)
Similarity:121/273 - (44%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            :.|:.|:|   |...:..|.::|....::||...|..:.|..|.:..|....:...|     .|.
Mosquito    56 DYPYQVSL---RRGRHFCGESIIDSQWILTAAHCTRTINARNLWIHVGSSHVNDGGE-----SVR 112

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM--PSAPKN----FDFSRCIFTGWGKN 240
            :|.|:.||..|..:. .:.:|:.|.:.|..|..:.||.:  |||.:.    .|.:.|..:|||..
Mosquito   113 VRRILHHPKQNSWSD-YDFSLLHLDQPLNLSESVQPIPLRKPSASEPTGELSDGTLCKVSGWGNT 176

  Fly   241 SFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLAC 304
            ...|.|.: ||:..::|:...:.|.:   :|.|.. .:..|::||| .|.|||||:||.|.||.|
Mosquito   177 HNPDESAL-VLRAATVPLTNHQQCSE---VYEGIG-SVTESMICAGYDEGGKDSCQGDSGGPLVC 236

  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSA 369
               |.    :|.|:|::|..|..||.|.||..|:...|||          |:......|||    
Mosquito   237 ---DG----QLTGVVSWGKGCAEPGYPGVYAKVSTAYEWI----------EQTVHTALASP---- 280

  Fly   370 GPYLNQWNQPNYE 382
                   .:||.|
Mosquito   281 -------ERPNVE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/233 (30%)
Tryp_SPc 113..344 CDD:238113 70/233 (30%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 70/233 (30%)
Tryp_SPc 46..272 CDD:238113 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.